ADAMTS13 Antibody

SKU: orb1536722

Description

ADAMTS13 Antibody

Research Area

Cardiovascular Research

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: IHC, IHC-P (1:200), WB (1:500 - 1:2000)
• Reactivity: Human, Mouse
• Application Notes:
  Further information: The predicted MW is 39kDa/144kDa/147kDa/153kDa, while the observed MW by Western blot was 156kDa/157kDa.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human ADAMTS13 (NP_620594.1). DMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQAS
• Target: ADAMTS13
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Concentration: 0.53 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ADAMTS13, ADAM-TS, ADAM-TS13, ADAMTS-13, ADAM-TS 13, C9orf8, TTP, VWF-CP, VWF-cleaving protease, VWFCP

Quick Database Links

Gene Symbol

ADAMTS13