ADAMDEC1 Rabbit Polyclonal Antibody

• Catalog Number: orb582617
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADAMDEC1
• Target: ADAMDEC1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1
• Protein Sequence: Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
• UniProt ID: O15204
• MW: 53 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: M12.219
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_055294

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 39 kDa isoform. The protein may be modified by glycosylation.

WB Suggested Anti-ADAMDEC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.