ADAM17 monoclonal antibody (M01), clone 1F6

• Catalog Number: orb2292104
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ADAM17.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F6
• Tested applications: ELISA, IHC-P, PLA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: ADAM17 (NP_003174, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV
• NCBI: NP_003174
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ADAM17 monoclonal antibody (M01), clone 1F6. Western Blot analysis of ADAM17 expression in human spleen.

Detection limit for recombinant GST tagged ADAM17 is approximately 3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to ADAM17 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between TGFA and ADAM17. HeLa cells were stained with anti-TGFA rabbit purified polyclonal 1:1200 and anti-ADAM17 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).