ACVR1B Rabbit Polyclonal Antibody

• Catalog Number: orb588964
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACVR1B
• Target: ACVR1B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACVR1B
• Protein Sequence: Synthetic peptide located within the following region: QRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRT
• UniProt ID: P36896
• MW: 57 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ALK4, SKR2, ACTRIB, ACVRLK4
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_004293.1

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Rat Liver, Antibody Dilution: 1 ug/ml.