ACTN4 Rabbit Polyclonal Antibody

SKU: orb578374

Description

Rabbit polyclonal antibody to ACTN4

Research Area

Disease Biomarkers, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN4
• Target: ACTN4
• Protein Sequence: Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA
• Molecular Weight: 100kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FSGS, FSGS1, ACTININ-4

WB Suggested Anti-ACTN4 Antibody Titration: 0.625 ug/ml, Positive Control: HCT116 cell lysate. ACTN4 is supported by BioGPS gene expression data to be expressed in HCT116.

Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: ACTN4.

Sample Type: ACTNX-GFP transfected COS-7 cells, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa-Fluor 568, Secondary Antibody Dilution: 1:100, Color/Signal Descriptions: Green: GFP Red: ACTN4, Gene Name: ACTN4.

Quick Database Links

Gene Symbol

ACTN4

UniProt

O43707

RefSeq (Protein):NP_004915