ACTN2 Rabbit Polyclonal Antibody

SKU: orb578076

Description

Rabbit polyclonal antibody to ACTN2

Research Area

Cell Biology, Disease Biomarkers, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACTN2
• Target: ACTN2
• Protein Sequence: Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD
• Molecular Weight: 98kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MPD6, CMH23, CMD1AA, MYOCOZ

Sample Tissue: Human PANC1, Antibody Dilution: 1.0 ug/ml.

Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: ACTN2.

Rabbit Anti-ACTN2 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ACTN2 Antibody Titration: 1.25 ug/ml, Positive Control: Human heart.

Quick Database Links

Gene Symbol

ACTN2

UniProt

P35609

RefSeq (Protein):NP_001094