You have no items in your shopping cart.
Cart summary
ACOT4 Peptide - middle region
Catalog Number: orb2005210
Product Properties
| Catalog Number | orb2005210 |
|---|---|
| Category | Proteins |
| Description | ACOT4 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: NALV GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH |
| UniProt ID | Q8N9L9 |
| MW | 46kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with ACOT4 Rabbit Polyclonal Antibody (orb583985). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | PTE-Ib, PTE1B, PTE2B |
| Note | For research use only |
| NCBI | NP_689544 |
| Expiration Date | 6 months from date of receipt. |
Images
Reviews
ACOT4 Peptide - middle region (orb2005210)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review