Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ACLY Rabbit Polyclonal Antibody

SKU: orb330255

Description

ACLY Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ACLY. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human ACLY. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ACLY
TargetACLY
Protein SequenceSynthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA
Molecular Weight121kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ACL antibody, anti ATPCL antibody, anti CLATP antibody

Similar Products

  • ATP citrate lyase/ACLY Rabbit Polyclonal Antibody [orb381026]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • ACLY Rabbit Polyclonal Antibody [orb5743]

    WB

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • ACLY Rabbit Polyclonal Antibody [orb393195]

    ELISA,  IF,  IHC,  WB

    Bovine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • ACLY Rabbit Polyclonal Antibody [orb624955]

    ELISA,  FC,  IF,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • ACLY Antibody [orb675338]

    ELISA,  IF,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ACLY Rabbit Polyclonal Antibody

Rabbit Anti-ACLY Antibody, Catalog Number: orb330255, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

ACLY Rabbit Polyclonal Antibody

WB Suggested Anti-ACLY Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, ACLY is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001087

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ACLY Rabbit Polyclonal Antibody (orb330255)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry