You have no items in your shopping cart.
Cart summary
Acetoacetate decarboxylase Protein, Clostridium acetobutylicum, Recombinant (His)
Catalog Number: orb1979507
| Catalog Number | orb1979507 |
|---|---|
| Category | Proteins |
| Description | Catalyzes the conversion of acetoacetate to acetone and carbon dioxide. Acetoacetate decarboxylase Protein, Clostridium acetobutylicum, Recombinant (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is P23670. |
| Tag | C-6xHis |
| Purity | 98.00% |
| Protein Sequence | MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFARTMLKDEVIKQISTPLTSPAFPRGPYKFHNREYFNIVYRTDMDALRKVVPEPLEIDEPLVRFEIMAMHDTSGLGCYTESGQAIPVSFNGVKGDYLHMMYLDNEPAIAVGRELSAYPKKLGYPKLFVDSDTLVGTLDYGKLRVATATMGYKHKALDANEAKDQICRPNYMLKIIPNYDGSPRICELINAKITDVTVHEAWTGPTRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEVIYDYLK |
| UniProt ID | P23670 |
| MW | 33.2 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | Baculovirus Insect Cells |
| Biological Origin | Clostridium acetobutylicum |
| Biological Activity | Catalyzes the conversion of acetoacetate to acetone and carbon dioxide. Acetoacetate decarboxylase Protein, Clostridium acetobutylicum, Recombinant (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 33.2 kDa and the accession number is P23670. |
| Expression Region | 1-244 aa |
| Storage | -20°C |
| Note | For research use only |
