Cart summary

You have no items in your shopping cart.

    ACCN1/ASIC2 Antibody

    Catalog Number: orb381048

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb381048
    CategoryAntibodies
    DescriptionACCN1/ASIC2 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ReactivityHuman, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml, Human, Rat
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW57709 MW
    UniProt IDQ16515
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesAcid-sensing ion channel 2;ASIC2;Amiloride-sensiti
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    ACCN1/ASIC2 Antibody

    WB analysis of ACCN1 using anti-ACCN1 antibody.Lane 1:rat testis tissue; 2:MCF-7 cell.

    • ACCN1/ASIC2 Antibody [orb623787]

      ELISA,  FC,  ICC,  IF,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars