ACAT1 Rabbit Polyclonal Antibody

• Catalog Number: orb330738
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACAT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACAT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41
• Target: ACAT1
• UniProt ID: P24752
• Protein Sequence: Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH
• NCBI: NP_000010
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ACAT antibody, anti MAT antibody, anti T2 ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Fetal heart

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Lung Tumor (T-LU), Antibody concentration: 3 ug/ml.

WB Suggested Anti-ACAT1 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate, ACAT1 is supported by BioGPS gene expression data to be expressed in HepG2.