Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

Ac Rabbit Polyclonal Antibody

SKU: orb325671

Description

Ac Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ac. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Fruit fly. This antibody reacts with Drosophila samples and is predicted to react with Human, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityDrosophila
Predicted ReactivityHuman, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Fruit fly
Targetac
Protein SequenceSynthetic peptide located within the following region: FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
Molecular Weight23kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 990 E5 F1 antibody, anti AS-C T5 antibody, anti AS-C T5ac antibody, anti ASC antibody, anti CG3796 antibody, anti EG:125H10.3 antibody, anti Hw antibody, anti T5 antibody, anti ascT5 antibody, anti sc/T5 antibody, anti Ac antibody, anti AC antibody, anti Ac/Sc antibody, anti Dmel\CG3796 antibody

Similar Products

  • P53 (Acetyl K382) Rabbit Polyclonal Antibody [orb11497]

    FC,  IF,  IHC-Fr,  IHC-P

    Canine

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Caspase-3 Rabbit Polyclonal Antibody [orb10237]

    ELISA,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Histone H4 (Acetyl K12) Rabbit Polyclonal Antibody [orb6172]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Caspase 3 precursor Rabbit Polyclonal Antibody [orb13278]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MUC5AC Rabbit Polyclonal Antibody [orb157913]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Ac Rabbit Polyclonal Antibody

WB Suggested Anti-ac Antibody Titration: 0.2-1 ug/mL, Positive Control: Drosophila.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_476824

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Ac Rabbit Polyclonal Antibody (orb325671)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry