ABP1 Protein, Zea mays, Recombinant (His)

• Catalog Number: orb1976184
• Category: Proteins
• Description: Receptor for the plant hormone auxin.
• Tag: N-6xHis
• Purity: 98.00%
• Protein Sequence: SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL
• UniProt ID: P13689
• MW: 22.4 kDa (predicted)
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expression System: E. coli
• Biological Origin: Zea mays
• Biological Activity: Receptor for the plant hormone auxin.
• Expression Region: 39-201 aa
• Storage: -20°C
• Note: For research use only