ABI1 Rabbit Polyclonal Antibody

• Catalog Number: orb585640
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ABI1
• Target: ABI1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: IEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPG
• UniProt ID: B6VEX5
• MW: 42kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: E3B1, ABI-1, ABLBP4, NAP1BP, SSH3BP, SSH3BP1
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_001171595

WB Suggested Anti-ABI1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. ABI1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.