ABCG8 Antibody

• Catalog Number: orb389440
• Category: Antibodies
• Description: ABCG8 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 75679 MW
• UniProt ID: Q9H221
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: ATP-binding cassette sub-family G member 8;Steroli
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of ABCG8 using anti-ABCG8 antibody.Lane 1:human HL-60 cell; 2:human K562 cell; 3:human HepG2 cell; 4:rat liver tissue; 5:rat PC-12 cell; 6:mouse liver tissue; 7:mouse HEPA1-6 cell.

IF analysis of ABCG8 using anti-ABCG8 antibody. ABCG8 was detected in an immunocytochemical section of HepG2 cells.