ABCD4 Rabbit Polyclonal Antibody

• Catalog Number: orb330327
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ABCD4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ABCD4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: ABCD4
• UniProt ID: O14678
• Protein Sequence: Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA
• NCBI: EAW81165
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ABC41 antibody, anti EST352188 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ABCD4 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, ABCD4 is supported by BioGPS gene expression data to be expressed in HepG2.