ABCB4 Rabbit Polyclonal Antibody

SKU: orb578192

Description

Rabbit polyclonal antibody to ABCB4

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABCB4
• Target: ABCB4
• Protein Sequence: Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM
• Molecular Weight: 142 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GBD1, ICP3, MDR2, MDR3, PGY3, ABC21, MDR2/3, PFIC-3

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide seaquence is present at 40 kDa.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

ABCB4

UniProt

A4D1D4

RefSeq (Protein):NP_000434