AADACL3 Rabbit Polyclonal Antibody

SKU: orb585539

Description

AADACL3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting AADACL3. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Human. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Human

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	AADACL3
Protein Sequence	Synthetic peptide located within the following region: VVTDFRFGTIPVKLYQSKASTCTLKPGIVYYHGGGGVMGSLKTHHGICSR
Molecular Weight	40kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

RP11-474O21.3

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

AADACL3

UniProt

Q5VUY0

RefSeq (Protein):NP_001096640

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001096640

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	ELISA, IHC, WB
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, IHC-Fr, IHC-P, WB
Predicted Reactivity:	Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	HRP

Applications:	ICC, IF
Predicted Reactivity:	Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	RBITC

Applications:	ICC, IF
Predicted Reactivity:	Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	PE/Cy5