A4GALT Rabbit Polyclonal Antibody

SKU: orb580015

Description

Rabbit polyclonal antibody to A4GALT

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human A4GALT
• Target: A4GALT
• Protein Sequence: Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI
• Molecular Weight: 40kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

P1, PK, Gb3S, P(k), P1PK, A14GALT, A4GALT1

Positive control (+): Human Small Intestine (IN), Negative control (-): Human Kidney (KI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-A4GALT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.

Quick Database Links

Gene Symbol

A4GALT

UniProt

Q9NPC4

RefSeq (Protein):NP_059132