5HT2A Receptor antibody

• Catalog Number: orb1177025
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR2A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Rat
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
• Dilution range: Western blot: 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• Target: HTR2A
• Storage: At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing
• Buffer/Preservatives: Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request
• Alternative names: 5 HT 2 antibody, 5 HT 2A antibody, 5 HT2 receptor
• Note: For research use only
• Expiration Date: 12 months from date of receipt.