You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb312125 |
---|---|
Category | Antibodies |
Description | 5HT2A Receptor/HTR2A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 52603 MW |
UniProt ID | P28223 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | 5-hydroxytryptamine receptor 2A;5-HT-2;5-HT-2A;Ser Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of 5HT2A Receptor using anti-5HT2A Receptor antibody.Lane 1:Rat Brain Tissue;2:Rat Testis Tissue;3:U87 Cell.
IHC analysis of 5HT2A Receptor using anti-5HT2A Receptor antibody.5HT2A Receptor was detected in paraffin-embedded section of human glioma tissues.
IHC analysis of 5HT2A Receptor using anti-5HT2A Receptor antibody.5HT2A Receptor was detected in paraffin-embedded section of rat brain tissues.
IHC, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating