5HT2A Receptor/HTR2A Antibody

• Catalog Number: orb312125
• Category: Antibodies
• Description: 5HT2A Receptor/HTR2A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 52603 MW
• UniProt ID: P28223
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: 5-hydroxytryptamine receptor 2A;5-HT-2;5-HT-2A;Ser
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of 5HT2A Receptor using anti-5HT2A Receptor antibody.Lane 1:Rat Brain Tissue;2:Rat Testis Tissue;3:U87 Cell.

IHC analysis of 5HT2A Receptor using anti-5HT2A Receptor antibody.5HT2A Receptor was detected in paraffin-embedded section of human glioma tissues.

IHC analysis of 5HT2A Receptor using anti-5HT2A Receptor antibody.5HT2A Receptor was detected in paraffin-embedded section of rat brain tissues.