ZSC29 antibody

• Catalog Number: orb324631
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZSC29
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Human, Porcine
• Reactivity: Equine, Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZSC29
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 93kDa
• Target: ZSCAN29
• UniProt ID: Q8IWY8
• Protein Sequence: Synthetic peptide located within the following region: TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAVITRAPVLFQSPRGFE
• NCBI: XP_006720464
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ZSCAN29 antibody, anti ZNF690 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Liver tissue using ZSC29 antibody