Cart summary

You have no items in your shopping cart.

    ZSC22 antibody

    Catalog Number: orb325364

    DispatchUsually dispatched within 1 - 2 weeks
    $ 609.00
    Catalog Numberorb325364
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to ZSC22
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityCanine, Human
    ReactivityCanine, Human
    ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC22
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW54kDa
    TargetZSCAN22
    UniProt IDP10073
    Protein SequenceSynthetic peptide located within the following region: ESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIH
    NCBIXP_006723255
    StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesanti ZSCAN22 antibody, anti HKR2 antibody, anti ZN
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    ZSC22 antibody

    Western blot analysis of human Fetal Liver tissue using ZSC22 antibody

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars