ZP3 Antibody

• Catalog Number: orb527042
• Category: Antibodies
• Description: ZP3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human ZP3 (LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 47 kDa
• UniProt ID: P21754
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Zona pellucida sperm-binding protein 3; Sperm rece
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB analysis of ZP3 using anti-ZP3 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human A549 cell;4:human T-47D cell;5:human PC-3 cell;6:human U2OS cell.