Cart summary

You have no items in your shopping cart.

ZNF676 Rabbit Polyclonal Antibody (Biotin)

ZNF676 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2100505

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2100505
CategoryAntibodies
DescriptionZNF676 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human ZNF676
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW64kDa
UniProt IDQ8N7Q3
Protein SequenceSynthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC
NCBINP_001001411
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.