ZNF345 Antibody

• Catalog Number: orb2236385
• Category: Antibodies
• Description: ZNF345 Antibody
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6G10
• Tested applications: ELISA, IHC-P, WB
• Isotype: IgG2b Kappa
• Immunogen: ZNF345 (NP_003410, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Form/Appearance: Liquid
• Conjugation: Unconjugated
• Protein Sequence: MENLTKHSIECSSFRGDWECKNQFERKQGSQEGHFSEMIFTPEDMPTFSIQHQRIHTDEKLLECKECGKDFSFVSVLVRHQRIHTGEKPYECKECGKAFGSGANLAYHQRI
• NCBI: NP_003410
• Storage: Store at -2°C or lower. Aliquot to avoid repeated freezing and thawing.
• Buffer/Preservatives: Liquid
• Alternative names: HZF10;zinc finger protein 345;zinc finger protein
• Note: For research use only
• Expiration Date: 12 months from date of receipt.