ZN618 antibody

• Catalog Number: orb324408
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZN618
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZN618
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 104kDa
• Target: ZNF618
• UniProt ID: Q5T7W0
• Protein Sequence: Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ZNF618 antibody, anti KIAA1952 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HepG2 Whole Cell tissue using ZN618 antibody