ZN614 antibody

• Catalog Number: orb324580
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZN614
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Human
• Reactivity: Canine, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZN614
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: ZNF614
• UniProt ID: Q8N883
• Protein Sequence: Synthetic peptide located within the following region: LFTKHLKTNTTDKICIPNEYRKGSTVKSSLITHQQTHTEEKSYMCSECGK
• NCBI: NP_079316
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ZNF614 antibody, anti antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HepG2 Whole Cell tissue using ZN614 antibody