ZMYND10 monoclonal antibody (M24), clone 3D11

• Catalog Number: orb2291142
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ZMYND10.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D11
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ZMYND10 (NP_056980.2, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LERENRGKWQAIAKHQLQHVFSPSEQDLWLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK
• NCBI: NP_056980.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ZMYND10 is 0.03 ng/ml as a capture antibody.

Western Blot analysis of ZMYND10 expression in transfected 293T cell line by ZMYND10 monoclonal antibody (M24), clone 3D11. Lane 1: ZMYND10 transfected lysate (Predicted MW: 50.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).