You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291142 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ZMYND10. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3D11 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | ZMYND10 (NP_056980.2, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | LERENRGKWQAIAKHQLQHVFSPSEQDLWLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK |
NCBI | NP_056980.2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged ZMYND10 is 0.03 ng/ml as a capture antibody.
Western Blot analysis of ZMYND10 expression in transfected 293T cell line by ZMYND10 monoclonal antibody (M24), clone 3D11. Lane 1: ZMYND10 transfected lysate (Predicted MW: 50.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).