You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
ZFP36L1 monoclonal antibody (M02), clone 1A3
Catalog Number: orb2295382
| Catalog Number | orb2295382 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant ZFP36L1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 1A3 |
| Tested applications | ELISA, WB |
| Reactivity | Human |
| Isotype | IgG1 Kappa |
| Immunogen | ZFP36L1 (NP_004917, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG |
| NCBI | NP_004917 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (37.62 KDa).
Detection limit for recombinant GST tagged ZFP36L1 is approximately 1 ng/ml as a capture antibody.
Western Blot analysis of ZFP36L1 expression in transfected 293T cell line by ZFP36L1 monoclonal antibody (M02), clone 1A3. Lane 1: ZFP36L1 transfected lysate(36.3 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of ZFP36L1 over-expressed 293 cell line, cotransfected with ZFP36L1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ZFP36L1 monoclonal antibody (M02), clone 1A3 (Cat # orb2295382). GAPDH (36.1 kDa) used as specificity and loading control.
