Zfp192 antibody

• Catalog Number: orb576320
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Zfp192
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Animal, Bovine, Canine, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: Zkscan8
• UniProt ID: Q8BSL0
• Protein Sequence: Synthetic peptide located within the following region: SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ
• NCBI: NP_631880
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LD5-, LD5-1, Zfp19, Zfp192, 2510038J07Rik, D430019
• Note: For research use only
• Expiration Date: 12 months from date of receipt.