You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292083 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ZEB1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ZEB1 (NP_110378, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE |
Tested applications | ELISA, IF, WB |
Clone Number | 4C4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_110378 |
Detection limit for recombinant GST tagged ZEB1 is 3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell. [antibody concentration 10 ug/ml]
Immunofluorescence of monoclonal antibody to ZEB1 on U-2 OS cell. [antibody concentration 10 ug/ml]
U-2 OS cells were stained with ZEB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
Western Blot detection against Immunogen (36.74 KDa).