You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334643 |
---|---|
Category | Antibodies |
Description | ZBTB7A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine, Canine, Monkey |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 61439 MW |
UniProt ID | O95365 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Zinc finger and BTB domain-containing protein 7A;F Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of MCF-7 cells using anti-ZBTB7A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of ZBTB7A using anti-ZBTB7A antibody.Lane 1:human MCF-7 cell.
IF analysis of ZBTB7A using anti-ZBTB7A antibody. ZBTB7A was detected in immunocytochemical section of A431 cells.
IHC analysis of ZBTB7A using anti-ZBTB7A antibody. ZBTB7A was detected in a paraffin-embedded section of human intestinal cancer tissue.
ELISA, IF, IHC-P, WB | |
Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating