ZAP-70 Antibody (Phospho-Tyr315)

• Catalog Number: orb2240627
• Category: Antibodies
• Description: ZAP-70 Antibody (Phospho-Tyr315)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IF, IHC, IHC-P, WB
• Immunogen: The antiserum was produced against synthesized peptide derived from human ZAP-70 around the phosphorylation site of Tyr315.
• Conjugation: Unconjugated
• MW: 69 kDa
• UniProt ID: P43403
• Protein Sequence: Synthetic peptide located within the following region: QRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKL
• Storage: -20°C
• Alternative names: 70 kDa zeta-associated protein;70 kDa zeta-chain a
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1:1000IHC: 1:50~1:100ELISA: 1:1000
• Expiration Date: 12 months from date of receipt.