You have no items in your shopping cart.
Cart summary
YTFE Protein, E. coli, Recombinant (GST)
Catalog Number: orb1979272
| Catalog Number | orb1979272 |
|---|---|
| Category | Proteins |
| Description | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. YTFE Protein, E. coli, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 51.9 kDa and the accession number is P69506. |
| Tag | N-GST |
| Purity | 98.00% |
| MW | 51.9 kDa (predicted) |
| UniProt ID | P69506 |
| Protein Sequence | MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. YTFE Protein, E. coli, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 51.9 kDa and the accession number is P69506. |
| Expression Region | 1-220 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
