YBX2 Rabbit Polyclonal Antibody

• Catalog Number: orb575091
• Category: Antibodies
• Description: Rabbit polyclonal antibody to YBX2
• Target: YBX2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human YBX2
• Protein Sequence: Synthetic peptide located within the following region: RKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPP
• UniProt ID: Q9Y2T7
• MW: 39kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DBPC, MSY2, CSDA3, CONTRIN
• Research Area: Epigenetics & Chromatin, Molecular Biology, Stem C
• Note: For research use only
• NCBI: NP_057066

Human kidney

WB Suggested Anti-YBX2 Antibody Titration: 1.0 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.