You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291870 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant YARS. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F3 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse |
Isotype | IgG1 Kappa |
Immunogen | YARS (AAH01933, 1 a.a. ~ 528 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS |
NCBI | AAH01933 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged YARS is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (83.82 KDa).
YARS monoclonal antibody (M02), clone 2F3 Western Blot analysis of YARS expression in HeLa.
YARS monoclonal antibody (M02), clone 2F3. Western Blot analysis of YARS expression in NIH/3T3.