You have no items in your shopping cart.
Cart summary
YAP1 Protein, Human, Recombinant (Isoform 9, His)
Catalog Number: orb1979904
| Catalog Number | orb1979904 |
|---|---|
| Category | Proteins |
| Description | YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9. |
| Tag | C-6xHis |
| Purity | 89.00% |
| MW | 56.4 kDa (predicted); 80 kDa (reducing conditions) |
| UniProt ID | P46937 |
| Protein Sequence | MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | YAP1 Protein, Human, Recombinant (Isoform 9, His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 56.4 kDa; 80 kDa, reducing conditions and the accession number is P46937-9. |
| Expression Region | 1-508 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
