WWP1 monoclonal antibody (M01A), clone 1A7

• Catalog Number: orb2291453
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant WWP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A7
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
• NCBI: NP_008944
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody (M01A), clone 1A7. Lane 1: WWP1 transfected lysate(105.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).