WNV Pre-M Protein

• Catalog Number: orb2024102
• Category: Proteins
• Description: WNV Pre-M Protein
• Tested applications: ELISA, WB
• Form/Appearance: 20mM phosphate buffer pH 7.5.
• Purity: Protein is > 95% pure as determined by 10% PAGE (coomassie staining).Purification Method: Purified by proprietary chromatographic technique.
• Protein Sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
• Storage: Protein is shipped at ambient temperature. Upon arrival, Store at -2°C. Stability: Five years frozen. One month in solution at room temperature.
• Buffer/Preservatives: 20mM phosphate buffer pH 7.5.
• Alternative names: WNV Pre-M, West Nile Virus Pre-M Recombinant
• Note: For research use only
• Application notes: Application Info: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
• Expiration Date: 6 months from date of receipt.