Wnt6 Rabbit Polyclonal Antibody

SKU: orb579861

Description

Rabbit polyclonal antibody to Wnt6

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Wnt6
• Target: Wnt6
• Protein Sequence: Synthetic peptide located within the following region: PGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQL
• Molecular Weight: 40 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Wnt-, Wnt-6, AA409270

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. A smaller isoform of ~ 36 kDa may be detected in some tissues using this antibody.

Sample Type: Mouse Kidney lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

Wnt6

UniProt

P22727

RefSeq (Protein):NP_001101696