You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291967 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant WNT5A. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3A4 |
Tested applications | ELISA, IHC-P |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV |
NCBI | AAH64694 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged WNT5A is 3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to WNT5A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]