You have no items in your shopping cart.
Cart summary
WISP2/CCN5 Protein, Mouse, Recombinant (His & SUMO)
Catalog Number: orb1977350
| Catalog Number | orb1977350 |
|---|---|
| Category | Proteins |
| Description | May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 40.5 kDa (predicted) |
| UniProt ID | Q9Z0G4 |
| Protein Sequence | QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production. |
| Expression Region | 24-251 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
