WISP2 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2291817
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human WISP2 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: No additive
• Immunogen: WISP2 (NP_003872.1, 1 a.a. ~ 250 a.a) full-length human protein.
• Protein Sequence: MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
• Tested applications: IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_003872.1

Immunoprecipitation of WISP2 transfected lysate using anti-WISP2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with WISP2 MaxPab mouse polyclonal antibody (B01).

WISP2 MaxPab rabbit polyclonal antibody. Western Blot analysis of WISP2 expression in mouse liver.