WIPI1 monoclonal antibody (M02), clone 3C1

• Catalog Number: orb2291057
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant WIPI1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C1
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: WIPI1 (NP_060453.2, 348 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ
• NCBI: NP_060453.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged WIPI1 is 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.52 KDa).

WIPI1 monoclonal antibody (M02), clone 3C1 Western Blot analysis of WIPI1 expression in PC-12.