WEE1 monoclonal antibody (M01A), clone 5B6

• Catalog Number: orb2291969
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant WEE1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgM Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In ascites fluid
• Immunogen: WEE1 (NP_003381, 289 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAI
• Tested applications: ELISA, WB
• Clone Number: 5B6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_003381

WEE1 monoclonal antibody (M01A), clone 5B6 Western Blot analysis of WEE1 expression in Hela S3 NE.

Western Blot detection against Immunogen (36.74 KDa).