VWF / Von Willebrand Factor Antibody

• Catalog Number: orb1536619
• Category: Antibodies
• Description: VWF / Von Willebrand Factor Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human VWF (NP_000543.2). MYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLL
• Dilution range: IHC, IHC-P (1:200), WB (1:500 - 1:1000)
• Conjugation: Unconjugated
• Target: VWF / Von Willebrand Factor
• Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: VWF, Coagulation factor VIII VWF, F8VWF, VWD, Von
• Note: For research use only
• Application notes: Further information: The predicted MW is 38kDa/309kDa, while the observed MW by Western blot was 180kDa.
• Expiration Date: 12 months from date of receipt.