VSTM2L Protein, Human, Recombinant (His & SUMO)

• Catalog Number: orb2816017
• Category: Proteins
• Description: VSTM2L Protein, Human, Recombinant (His & SUMO) is expressed in E. coli with N-6xHis-SUMO. The accession number is Q96N03.
• Tag: N-6xHis-SUMO
• MW: 36.0 kDa (Predicted)
• UniProt ID: Q96N03
• Protein Sequence: TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
• Expression System: E. coli
• Biological Origin: Human
• Expression Region: 25-204 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.