VSIG2 antibody

• Catalog Number: orb592191
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VSIG2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse VSIG2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35 kDa
• Target: VSIG2
• UniProt ID: Q9Z109
• Protein Sequence: Synthetic peptide located within the following region: DLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVG
• NCBI: NP_065264.2
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CTX, Ctm, AU040484, 1190004B15Rik, 2210413P10Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.