You have no items in your shopping cart.
Cart summary
Viscumin Protein, Viscum album, Recombinant (His)
Catalog Number: orb1976214
| Catalog Number | orb1976214 |
|---|---|
| Category | Proteins |
| Description | The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. The B chain binds to cell receptors and probably facilitates the entry into the cell of the A chain; B chains are also responsible for cell agglutination (lectin activity). Inhibits growth of the human tumor cell line Molt4. Viscumin Protein, Viscum album, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 30.4 kDa and the accession number is P81446. |
| Tag | N-6xHis |
| Form/Appearance | Lyophilized from Tris-based buffer, 50% glycerol |
| Purity | > 90% as determined by SDS-PAGE |
| MW | 30.4 kDa (predicted) |
| UniProt ID | P81446 |
| Protein Sequence | YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Viscum album |
| Expression Region | 34-287 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
